PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G20840.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28942.2 Da    PI: 7.4329
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G20840.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.94.7e-27959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien +nrqvtfskRr g+lKKA+EL +LCda++ vi+fs tgk+yeyss
  OMERI04G20840.2  9 KKIENPTNRQVTFSKRRMGLLKKANELAILCDAQIGVIVFSGTGKMYEYSS 59
                     68***********************************************96 PP

2K-box55.32.8e-19851601488
            K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne.llleqieelqkkekelq 88 
                      +++  qe++++k+e++ L+   R+++G+dL sL+l++  +Leqq+e sl k+R +K++ ll +q+ e++++e ++ 
  OMERI04G20840.2  85 QQRIIQEMTRMKDENNRLRIIMRQYMGDDLASLTLQDVSNLEQQIEFSLYKVRLRKQQqLLDQQLLEMRNREMQIP 160
                      67889************************************************99986155567999999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.8E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.23161IPR002100Transcription factor, MADS-box
CDDcd002652.94E-39276No hitNo description
SuperFamilySSF554554.84E-30279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-28323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1681160IPR002487Transcription factor, K-box
PROSITE profilePS5129712.88885176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005774Cellular Componentvacuolar membrane
GO:0005777Cellular Componentperoxisome
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVELKK IENPTNRQVT FSKRRMGLLK KANELAILCD AQIGVIVFSG TGKMYEYSSP  60
PWRIANIFDR YLKAPSTRFE EMDVQQRIIQ EMTRMKDENN RLRIIMRQYM GDDLASLTLQ  120
DVSNLEQQIE FSLYKVRLRK QQQLLDQQLL EMRNREMQIP GDQSNYLCHM NLIGEQAQAP  180
PMVNPKPFPL WDVSGSSQMY NQDAESSMTA LQLSPQLHEY KLQPLQPNLQ EEANLHGYIP  240
KDTMEPGCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D7e-16260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-16260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-16260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A7e-16260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J9e-16260159Myocyte-specific enhancer factor 2A
3p57_I9e-16260159Myocyte-specific enhancer factor 2A
3p57_D9e-16260159Myocyte-specific enhancer factor 2A
3p57_C9e-16260159Myocyte-specific enhancer factor 2A
3p57_B9e-16260159Myocyte-specific enhancer factor 2A
3p57_A9e-16260159Myocyte-specific enhancer factor 2A
3kov_J9e-16260159Myocyte-specific enhancer factor 2A
3kov_I9e-16260159Myocyte-specific enhancer factor 2A
3kov_B9e-16260159Myocyte-specific enhancer factor 2A
3kov_A9e-16260159Myocyte-specific enhancer factor 2A
1tqe_S1e-15160160Myocyte-specific enhancer factor 2B
1tqe_R1e-15160160Myocyte-specific enhancer factor 2B
1tqe_Q1e-15160160Myocyte-specific enhancer factor 2B
1tqe_P1e-15160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1776980.0AY177698.1 Oryza sativa (japonica cultivar-group) transcription factor MADS31 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635707.11e-161PREDICTED: MADS-box transcription factor 31-like isoform X3
SwissprotQ84NC21e-100MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLA0A0E0DIA90.0A0A0E0DIA9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA017110-PA1e-159(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.16e-40MIKC_MADS family protein